knorrigt.com

Home > Ordenadores > Cómo convertir un archivo TXT para FASTA

Cómo convertir un archivo TXT para FASTA

Advertisement

Cómo convertir un archivo TXT para FASTA


Los estudios clínicos se llevan a cabo para analizar los datos de secuencias de proteínas y encontrar tratamientos para enfermedades. de datos de secuencias de proteínas se pone en la (todo-rápido) formato FASTA para que los programas de software a entender cómo procesar la secuencia de datos. El formato FASTA tiene un máximo de 80 caracteres por línea de datos de secuencia y utiliza el IUB / IUPAC (Unión Internacional de Bioquímica / Unión Internacional de Química Pura y Aplicada) estándar de código. La conversión de un TXT (texto plano) el archivo en formato FASTA implica editar o agregar datos de secuencias FASTA con formato a un archivo de texto existente con las líneas de datos de secuencias de proteínas. los programas de edición de texto como el Bloc de notas hacen de este sencillo de hacer.

Instrucciones

Abra el archivo de texto de secuencias de proteínas que desea editar en un programa de edición de texto, como el Bloc de notas.

Editar o añadir la línea de descripción que sigue el formato FASTA. Por ejemplo,> gi | 129295 | sp | P01013 | OVAX_CHICK gen X de proteínas (ovoalbúmina relacionada) es una línea de descripción válida FASTA. Esta línea ofrece una descripción única para las líneas de datos de secuencias que siguen. El formato FASTA requiere el uso del símbolo mayor que (>) para que el programa de software puede identificar la información descriptiva único y evitar el procesamiento de la descripción como una línea de secuencia de datos de proteínas.

Pulse la tecla "Enter" para insertar un salto de línea una vez que se edita la línea de descripción.

Editar o agregar el formato de línea de datos de secuencias de proteínas que se ajustan a los códigos estándar IUB / IUPAC. El estándar IUB / IUPAC utiliza las letras del alfabeto para representar los códigos aceptables o secuencias de consulta de aminoácidos o ácidos nucleicos en el formato FASTA. Por ejemplo, QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE
representa una línea de datos de secuencias válidas ya que comienza con la letra "Q", que representa la glutamina, y termina con la letra "E", que representa el glutamato.

Añadir más líneas de datos de secuencias, editar líneas de datos de secuencias existentes o añadir saltos de línea después de 80 caracteres, según sea necesario. La adhesión a los estándares de líneas de datos de secuencias FASTA y saltos de línea asegura que el programa sigue las instrucciones relacionadas con la glutamina, glutamato y otros códigos de letras. Las letras de la norma IUB / IUPAC son simplemente instrucciones al programa de software que procesa los datos con formato FASTA.

Haga clic en "Archivo", seleccione "Guardar" y luego haga clic en el botón "Guardar". Su archivo TXT está ahora en formato FASTA.

Cómo convertir un archivo TXT para SRT
El programa SubRip toma la información de subtítulos de películas y vídeos y la guarda en un archivo de texto con la extensión .srt. Debido a la popularidad relativa de este software de subtítulos de extracción de código abierto, el tipo de archivo s
Cómo convertir un archivo CSV para QIF
Muchos bancos sólo exportar información de la cuenta y la historia en un formato de base de datos de valores separados por comas (CSV). Si desea administrar los datos del software de gestión financiera populares Quicken, que necesita para convertir e
Cómo convertir un archivo CSV para Mac
La mayoría de los programas de bases de datos, procesadores de texto y hojas de cálculo ofrecen la opción de guardar un documento en otro formato para la compatibilidad entre plataformas y aplicaciones. El CSV o delimitado por comas, de formato conti
ADP archivos MDB y dos tipos de archivos de base de datos creados por Microsoft Access 97, 2000, 2002 y 2003. Los archivos de ADP son los archivos de datos SQL, mientras que los archivos MDB contienen información sobre el proyecto de Access el conjun
Un archivo con una extensión de archivo ".ptx" es un archivo RealLegal E-Transcript. Estos archivos se crean mediante la importación de datos ASCII (texto sin formato) a partir de un archivo de texto en la aplicación Administrador de E-Transcrip
archivos BIN, que son archivos binarios universales, son a diferencia de otros tipos de extensiones de archivo, ya que no están asociados con ningún programa específico. La conversión de un archivo BIN a una imagen ISO se puede hacer en sólo unos poc
Cómo convertir un archivo GIF en un archivo TXT
Un archivo .gif es una imagen estática que puede contener una fotografía, imágenes prediseñadas o incluso una página de texto. Sin embargo, el texto contenido dentro de una imagen .gif no se puede modificar, copiar o resaltada, lo cual puede ser muy
Para convertir un archivo TXT (texto) en un archivo CSV (valores separados por comas), que necesita para importar el archivo de texto en Microsoft Excel y guardar el archivo en formato CSV. Microsoft Excel tiene un asistente de importación para guiar
Cómo convertir un archivo a MP3
Alguna vez se preguntó cómo convertir un archivo de MP3? ¿Qué es un MP3? MP3 es un formato de medios utilizado por una gran cantidad de reproductores de música, coches, ordenadores y muchos otros artículos en estos días. Puede que no sea el mejor for
Una de las dificultades en conseguir los archivos de software desde un archivo ZIP es que a veces tendrá que ser convertido a un tipo de archivo diferente para ser utilizado correctamente los archivos. En algunos casos, la conversión de las carpetas
Cómo convertir un archivo CSV a un formato de archivo VCS
Un calendario codificado en formato de valores separados por comas (CSV) es útil para mover grandes cantidades de datos en torno a un formato de matriz reducidos al mínimo, pero no mucha gente lo que debe gestionar su calendario desde Excel. Para mej
El formato de documento portátil (PDF) es un tipo de archivo ampliamente utilizado que, básicamente, crea producciones digitales de los documentos originales que se pueden leer por cualquier persona con el software PDF-lectura. Para editar un documen
Cómo convertir un archivo JPEG a un mapa de bits
Para convertir un archivo JPEG a un mapa de bits en un Mac OS X, haga doble clic en el archivo JPEG, guardarlo en el escritorio y cambiar el formato de mapa de bits Microsoft. Abrir un archivos JPEG y guardarlo como un mapa de bits con la ayuda de un
Cómo comprimir un archivo VOB para caber en un DVD en blanco
A veces, los archivos en un DVD son demasiado grandes para ser quemado por un quemador de DVD doméstico estándar. A menudo, esto es el resultado de un video casero que se está grabando en un DVD de doble capa, lo que resulta en archivos que son simpl
Cómo convertir un archivo BIN a TXT
La conversión de un archivo binario (BIN) en un archivo de texto (.txt) es más fácil que el usuario medio puede pensar. El proceso de conversión de los dos archivos de uno a otro es tan fácil como unos pocos clics del ratón. Dado que los archivos .BI
La mayoría de cámaras digitales en estos días de captura imágenes en RAW, JPEG o TIFF en modo RGB. RGB significa rojo, verde y azul - los tres colores monitores como televisores, pantallas de ordenador y pantallas LCD de la cámara utilizar para mostr
Cómo convertir un archivo CSV a Excel
CSV tipo de archivo (conocida como valores separados por comas o archivos de texto delimitados por comas) es un formato de archivo fiable, la conversión de usar. Conversión de un archivo CSV a una hoja de cálculo de Excel puede ampliar las formas en
Cómo convertir un archivo XLR
XLR es la extensión de archivo asociado con los archivos de hojas de cálculo de Microsoft Works para la versión 6,0 a 9,0. Su mejor apuesta para convertir un archivo XLR es para abrirlo en Microsoft Works, que está preinstalado en la mayoría de los o
El proceso para convertir un archivo de imagen, tales como JPEG, en un formato de WordPad de texto enriquecido (RTF) o un archivo de texto TXT es conocido como OCR, o reconocimiento óptico de caracteres. El software especial identifica las formas de